Начальная страница Lexis Rex

Англи́йское Слово Дня

train



поезд
поезд


Определения

Английский > Русский
train
     1. поезд
Английский > Английский
train
     1. n. Elongated portion.
     2. n.          The elongated back portion of a dress or skirt (or an ornamental piece of material added to similar effect), which drags along the ground.
                   Unfortunately, the leading bridesmaid stepped on the bride's train as they were walking down the aisle.
     3. n.          A trail or line of something, especially gunpowder.
     4. n.          The tail of a bird.
     5. n.          (astronomy) A transient trail of glowing ions behind a large meteor as it falls through the atmosphere.
     6. n.          (now rare) An animal's trail or track.
     7. n. Connected sequence of people or things.
     8. n.          A group of people following an important figure, king etc.; a retinue, a group of retainers.
     9. n.          A group of animals, vehicles, or people that follow one another in a line, such as a wagon train; a caravan or procession.
                   Our party formed a train at the funeral parlor before departing for the burial.
     10. n.          A sequence of events or ideas which are interconnected; a course or procedure of something.
     11. n.          (military) The men and vehicles following an army, which carry artillery and other equipment for battle or siege.
     12. n.          A set of interconnected mechanical parts which operate each other in sequence.
     13. n.          A series of electrical pulses.
     14. n.          A series of specified vehicles, originally tramcars in a mine, and later especially railway carriages, coupled together.
     15. n.          A line of connected railway cars or carriages considered overall as a mode of transport; (as unnoun) rail travel.
                   The train will pull in at midday.
     16. n.          A long, heavy sleigh used in Canada for the transportation of merchandise, wood, etc.
     17. n.          (computing) A software release schedule.
     18. n.          (sex, slang) An act wherein series of men line up and then penetrate a person, especially as a form of gang rape.
     19. v. (intransitive) To practice an ability.
           She trained seven hours a day to prepare for the Olympics.
     20. v. To teach and form by practice; to educate; to exercise with discipline.
           You can't train a pig to write poetry.
     21. v. (intransitive) To improve one's fitness.
           I trained with weights all winter.
     22. v. To proceed in sequence.
     23. v. To move (a gun) laterally so that it points in a different direction.
           The assassin had trained his gun on the minister.
     24. v. (transitive, horticulture) To encourage (a plant or branch) to grow in a particular direction or shape, usually by pruning and bending.
           The vine had been trained over the pergola.
     25. v. (mining) To trace (a lode or any mineral appearance) to its head.
     26. v. (transitive, video games) To create a trainer for; to apply cheats to (a game).
     27. v. (obsolete) To draw along; to trail; to drag.
     28. v. (obsolete) To draw by persuasion, artifice, or the like; to attract by stratagem; to entice; to allure.
     29. n. (obsolete) Treachery; deceit.
     30. n. (obsolete) A trick or stratagem.
     31. n. (obsolete) A trap for animals; a snare.
     32. n. (obsolete) A lure; a decoy.
Русский > Английский
поезд
     1. n. поезд
     2. n. (dated) caravan, convoy, procession
     3. n. train, a line of connected railway cars
     4. n. (regional) a method of fishing, in which a fishing net is pulled by two side-by-side boats
     5. n. (regional) a net used for this method of fishing

Произношение




Примеры Предложений

Our stuff got stolen, and we missed our train.
    Наши вещи украли, и мы опоздали на наш поезд.
We arrived at the station a half-hour before the train started.
    Мы приехали на станцию за полчаса до отправления поезда.
They may have missed the train.
    Они, вероятно, опоздали на поезд.
The train left before I arrived at the station.
    Поезд ушёл до того, как я прибыл на станцию.
You must decide whether you will go by train or by plane.
    Ты должен решить, ехать на поезде, или на самолёте.



Повторить Предыдущие Слова

goattwenty-twowheelzero
tablesoapwaspbath
fortytwenty-fourcoldship
detectivenumber platesevensinger


balconychildhospitalflower
paintingdetergentredhorse
mealhandkerchieffamilyeggplant
bedwhiteboardsixty-threefather-in-law





Выучить
Слово Дня




Подпишитесь на Слово Дня
Электронная почта: